PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim05g009720.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 401aa    MW: 44023.2 Da    PI: 7.0238
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim05g009720.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1031.9e-32220275156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH+rF++a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Sopim05g009720.0.1 220 KQRRCWSPELHRRFLHALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 275
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.542217277IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.0E-29218278IPR009057Homeodomain-like
SuperFamilySSF466891.79E-18218278IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-27220275IPR006447Myb domain, plants
PfamPF002491.6E-7222273IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0055062Biological Processphosphate ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MMSNNNFSDK MERCQQYIDA LEQERTKIQV FSRELPLCLE LVTQAIETYK QQLSGTTTEY  60
NLNAQSTECS DDEHTSSDVP ILEEFIPLKS TFSHEDEDED ENDEENQSHK SKSFNNNNNN  120
STSSKDAKNK KSDWLRSVQL WNQTSDPTPK EELTPKKVSV VEVKKNGSGG AFHPFKKEKN  180
TVAAVETTPA LAGVVLAATG SSTAENSGGS KKEDKDGQRK QRRCWSPELH RRFLHALQQL  240
GGSHVATPKQ IRELMKVDGL TNDEVKSHLQ KYRLHTRRPS PSSIHNNNNQ QPPQFVVVGG  300
IWVPPPEYAS MAAGAPAASG EASGVANSNG IYAPIATHPK GPLHDHVSGG TLRQHNNKSS  360
RSERSSERDR SHSHSDCGGV HSNSPATSSS THTTTASPAY *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00218DAPTransfer from AT1G68670Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755170.0HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004238956.10.0PREDICTED: uncharacterized protein LOC101263023
TrEMBLK4BXE60.0K4BXE6_SOLLC; Uncharacterized protein
STRINGSolyc05g009720.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.15e-85G2-like family protein